USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
Papa Bear
Papa Bear
$15.44 inc. tax
$14.85 ex. tax
? Tax based on California, United States.
5x7 oval pine plaque Papa Bear
Picture has been burnt in to the wood
Has a hanger on the back
It has a clear coat to protect the picture
$15.44 inc. tax
$14.85 ex. tax
? Tax based on California, United States.
Add to Cart
Product Code: 6fd
Product Condition: New
Updating Order Details
Please do not refresh or navigate away from the page!
Details
Reviews

No Reviews Posted Yet - be the first!

write review
Related Products
Partner in crime
Fathers Day Signs
Partner in crime
$15.44
Add To Cart
Now here is a Father's Day plaque any dad would be proud of this is a 5x7 Pinewood plaque the saying...
Step dads
Fathers Day Signs
Step dads
$15.44
Add To Cart
Here's one for the step dad in your life It's a 5x7 pine wood plaque with a twine hanger on the back...
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i